PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00003.1.g05050.1.cf.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 731aa    MW: 82039.6 Da    PI: 6.8833
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00003.1.g05050.1.cf.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS394.11.5e-1203567271374
                            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseela 79 
                                     l++ L++cA+av+++d + a++lL+++++++ p+gd +qRla++f+ +L+arla+++s+ly++l +++t+    s+ l+
  Zjn_sc00003.1.g05050.1.cf.mkhc 356 LRTILIQCAQAVAADDRRSASELLKQIRQHSKPNGDGTQRLAHCFADGLEARLAGTGSQLYHQLVAKRTT---ASDMLK 431
                                     5789************************************************************999999...9***** PP

                            GRAS  80 alklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..ske 156
                                     a++l+  ++P+ ++sh++ Nq+Il  ++++++vHiiDf+i  G+QWp+L++ L++R++gpp lRiTg++ p++g   +e
  Zjn_sc00003.1.g05050.1.cf.mkhc 432 AYHLYLAACPFKRLSHFLSNQTILSMIKNATKVHIIDFGIYFGFQWPCLIRRLSKREGGPPLLRITGIDVPQPGfrPTE 510
                                     *************************************************************************9***** PP

                            GRAS 157 eleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvksls 235
                                     ++eetg+rLa++A+++ vpfe++  +a+++e+++ e+L+v ++E+++Vn+ ++  +l de+v+++s+r++vL+++++++
  Zjn_sc00003.1.g05050.1.cf.mkhc 511 RIEETGHRLAEYARKFAVPFEYQG-IASKWETIRAEDLKVGKDEVVIVNCLYRFRNLIDETVAVDSPRNRVLNTIRQVN 588
                                     ************************.7***************************************************** PP

                            GRAS 236 PkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlek 314
                                     P ++++   + +++ + F +rf eal ++salfd+lea++pr++ +r+ +Er l+gre+ nv+aceg++r+er et+++
  Zjn_sc00003.1.g05050.1.cf.mkhc 589 PAIFIHGIVNGSYSVPFFITRFREALFHFSALFDMLEATVPRDDAQRALIERDLFGREALNVIACEGSDRVERPETYKQ 667
                                     ******************************************************************************* PP

                            GRAS 315 WrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                     W+ r  +aGF +++ls++++++ak+ ++ ++ + + ++e+sg+l++gWk+r ++++SaW+
  Zjn_sc00003.1.g05050.1.cf.mkhc 668 WQVRNLRAGFVQAQLSQDIVTKAKAKVKDIYHKDFVIDEDSGWLLQGWKGRIIYAMSAWK 727
                                     *******************************888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.47330707IPR005202Transcription factor GRAS
PfamPF035145.3E-118356727IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 731 aa     Download sequence    Send to blast
MGLDNTYGEL SGMFCGGLSY DGFTDRSGSS DYFSFLNSQP EIVPQIATAP SSNPSSAISR  60
TNTETDNPED WEFISDESLN YISRMLMEED IDEKVSMYQA ESAALHAAAK PFYDILGHKF  120
PPSPDHQLIP WSLDSPVESG NSSHAQSYAS TATSSIGGAV DSNRRYDIGR SEQLALYGDL  180
RVQSSLPVLG PSSDACNEVS VLEDPLITNG RIPDYLFESL PTWDFRRGAE KAQKFLPGSD  240
KLVIDLEAGA VARPKEASKN VSPSTRKAEV LNTKKNRQSE DLDVLEGRSI KQSAFSSEEP  300
DWIEMFDDLL TEKKATVLRE MMRNEASKNS QVTQTKAPSG PRQRGRKPTK RDVVDLRTIL  360
IQCAQAVAAD DRRSASELLK QIRQHSKPNG DGTQRLAHCF ADGLEARLAG TGSQLYHQLV  420
AKRTTASDML KAYHLYLAAC PFKRLSHFLS NQTILSMIKN ATKVHIIDFG IYFGFQWPCL  480
IRRLSKREGG PPLLRITGID VPQPGFRPTE RIEETGHRLA EYARKFAVPF EYQGIASKWE  540
TIRAEDLKVG KDEVVIVNCL YRFRNLIDET VAVDSPRNRV LNTIRQVNPA IFIHGIVNGS  600
YSVPFFITRF REALFHFSAL FDMLEATVPR DDAQRALIER DLFGREALNV IACEGSDRVE  660
RPETYKQWQV RNLRAGFVQA QLSQDIVTKA KAKVKDIYHK DFVIDEDSGW LLQGWKGRII  720
YAMSAWKPNK N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-503607278375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004984720.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_004984721.10.0PREDICTED: scarecrow-like protein 9
TrEMBLK4A6B30.0K4A6B3_SETIT; Uncharacterized protein
STRINGSi034417m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP150538118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein